PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna24027.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 310aa    MW: 33816.9 Da    PI: 8.6347
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna24027.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.1e-191560147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEd+ l  +v+++G+++W++I++ ++ gR++k+c++rw + 
  mrna24027.1-v1.0-hybrid 15 KGPWSPEEDDALQSLVQKHGPRNWSLISKAIP-GRSGKSCRLRWCNQ 60
                             79******************************.***********985 PP

2Myb_DNA-binding543.9e-1769111347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  mrna24027.1-v1.0-hybrid  69 AFTPEEDDTIIRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 111
                              79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.1471065IPR017930Myb domain
SuperFamilySSF466892.7E-3212108IPR009057Homeodomain-like
SMARTSM007176.4E-171463IPR001005SANT/Myb domain
PfamPF002491.1E-181560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-261668IPR009057Homeodomain-like
CDDcd001675.32E-161759No hitNo description
SMARTSM007172.9E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.75767116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2369115IPR009057Homeodomain-like
PfamPF002491.3E-1469111IPR001005SANT/Myb domain
CDDcd001671.18E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MAMNRKEMDR MDRIKGPWSP EEDDALQSLV QKHGPRNWSL ISKAIPGRSG KSCRLRWCNQ  60
LSPQVEHRAF TPEEDDTIIR AHARFGNKWA TIARLLSGRT DNAIKNHWNS TLKRKCSSMS  120
DDGNGNGVGY DGNFHEQPPL KRSVSAGSGV PVSTELFMNP GSPSGSDLSD SSVQVMSPSH  180
VYRPVARSGG VLPPVETTSS SNNNNINLNS DPPTSLSLSL PGVDSCEVSN HRVAAVVEST  240
QNQAAAQPAA YDPMRSFPAE LLELVQGMIK KEVRSYMEGL EQSGFGVMRQ QSDGFRNVAV  300
KRIGISRIE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-41141163105MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-41141163105C-Myb DNA-Binding Domain
1msf_C5e-41141163105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287994.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-93MYB44_ARATH; Transcription factor MYB44
TrEMBLM5W0251e-142M5W025_PRUPE; Uncharacterized protein
STRINGVIT_07s0129g01050.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.17e-79myb domain protein 73